30
Day 1Day 2Day 3Day 4Day 5Day 6Day 7Day 8Day 9Day 10Day 11Day 12Day 13Day 14Day 15Day 16Day 17Day 18Day 19Day 20Day 21Day 22Day 23Day 24Day 25Day 26Day 27Day 28Day 29Day 3027
Intuitiveness · Days 21–30Day 27

The Wardrobe · Traits, Character, Perfection

Donning the Law of the Day

Herkimer Diamond · the jewel she gains

A woman does not rise by trying harder. She rises by putting on clothes and shoes. The C words are the garments — perfect traits that become virtues, and then become the attributes of an organization. The E words are the shoes — the character of the business, how it actually walks. The O words are the office she steps into and the resource she increases. Dressed this way, she does not stay a novice: she simply puts her business in its proper form, and a proper form profits, and then prospers.

Layer One

Adventure CEO

The Novice · She makes a thing profitable

Layer Two

Architect CEO

The Builder · She builds the house that holds it

Layer Three

Sovereign CEO

The Queen · She increases the estate

C

The Attribute · WHO she is

The C Words — Traits that become Virtues

These are the perfect traits — adjectives first, virtues once they are lived. Worn daily, they become the attributes of an organization: a business that is trusted because the woman behind it is.

Adventure CEO

Correctible

adjective · attribute of God

Able to be corrected and able to correct — the contrite, undefended woman, which is the only kind who can be perfected.

  1. 01Capable of being corrected, set right or made true
  2. 02From corrigere — to make straight together, to bring to rule
  3. 03Teachable; open to being shown a better line
  4. 04Contrite — willing to be wrong out loud
  5. 05Not defended, and therefore not stuck
  6. 06Able to correct constantly, without drama each time
  7. 07The condition that makes mastery possible at all
  8. 08Fault treated as information rather than identity
  9. 09Answerable to the plumb line rather than to pride
  10. 10Correctable in small increments, every day
teachablefixableopenhumbleadjustableamendablecoachablecontritewillingimprovable
Study Correctible
Architect CEO

Corrective

adjective · attribute of God

Constantly making better — she does not only receive correction, she supplies it.

  1. 01Tending to correct, remedy or set right
  2. 02The office that turns a fault into a standard
  3. 03Making better as a habit rather than as a crisis
  4. 04Applied to the work, never to the worth of a person
  5. 05Constructive correction — the fix arrives with the finding
  6. 06Adjustment made early, while it is still cheap
  7. 07The lens that brings a blurred thing into focus
  8. 08Not critical; corrective — criticism stops, correction continues
  9. 09The instinct to true a line the moment it drifts
  10. 10Improvement as a standing condition of her house
remedialimprovingrepairingadjustingrestorativerectifyingfixingrefiningtuningsetting right
Study Corrective
Sovereign CEO

Correct

adjective · attribute of God

True, plumb, foundationally sound — and settled in it, with the quiet pleasure of a straight line.

  1. 01In accordance with fact, truth or the standard
  2. 02Plumb — square to the line it was measured against
  3. 03Free from error because the error was taken out
  4. 04Settled: no longer arguing, adjusting or defending
  5. 05Foundationally sound — right where it cannot be seen
  6. 06Proper, exact, and therefore restful
  7. 07The state a corrected thing arrives at and stays in
  8. 08Right in a way that others can build on top of
  9. 09Accurate under inspection, not only at a glance
  10. 10The enjoyment of a thing that is finally true
righttrueaccurateexactpropersoundprecisefaultlessplumbjust so
Study Correct
E

The Character · HOW she works

The E Words — The Character of the Business

These are the verbs. The character of a thing is what it does repeatedly. A business has no character until it establishes, extends, and expands on purpose — this is the shoe that walks the law.

Adventure CEO

Envision

verb · the doing of it

To see the finished thing before it exists — and by seeing it, to know which dial to turn.

  1. 01To picture a thing as it will be, completed
  2. 02From en- + vision — to put into sight
  3. 03To hold the finished version in view while the rough one is in hand
  4. 04To see what to do next because the end is already visible
  5. 05To enquire of the picture: what is missing here?
  6. 06To imagine with intent to build, not to daydream
  7. 07To set a standard by seeing it first
  8. 08To change the dial — and so to change the outcome
  9. 09To compare what is to what should be
  10. 10To carry the finished image as a working tool
pictureimagineforeseevisualizeconceiveseeprojectdream upanticipatebehold
Study Envision
Architect CEO

Emend

verb · the doing of it

To remove the fault from the thing itself — the scholar's word for repairing a text until it reads true.

  1. 01To correct and revise a text, record or plan
  2. 02From emendare — e- (out) + menda (fault): to take the fault out
  3. 03To repair the document rather than defend the draft
  4. 04To make a small, exact change that restores the meaning
  5. 05To improve by removing error, not by adding decoration
  6. 06The editor's act: line by line until it is right
  7. 07To work on the thing instead of arguing about the thing
  8. 08To fix quietly, and keep the record clean
  9. 09To amend with precision — the least change that makes it true
  10. 10To leave a version behind that no longer needs excuses
correctreviseamendeditrepairrectifyimprovepolishadjustclean up
Study Emend
Sovereign CEO

Envisage

verb · the doing of it

Not envisioning. Envisage faces the thing and shows the steps — each stage required to get there.

  1. 01To form a plan of a future thing, stage by stage
  2. 02From en- + visage (face) — to face a thing directly
  3. 03To see not only the end but the route to it
  4. 04To contemplate as something that will actually be carried out
  5. 05To lay out the staircase rather than the summit
  6. 06To regard a possibility as a schedule
  7. 07To picture the process, where envision pictures the product
  8. 08To foresee what each stage will cost
  9. 09To face the work squarely and describe it in order
  10. 10Vision converted into sequence
foreseeplancontemplateanticipatepicturemap outconceiveexpectproposeface
Study Envisage
O

The Perfection · WHAT she holds and increases

The O Words — The Perfection and the Office

These are the nouns — the office she holds and the resource she increases. When the trait and the character are in place, the form is proper, and a proper form profits and then prospers.

Adventure CEO

Overview

noun · the office and the resource

One view of the whole thing from above — the first altitude a woman gains over her own work.

  1. 01A general survey of the whole taken from above
  2. 02A summary that keeps every part in relation to the others
  3. 03The view that shows what is missing rather than what is loud
  4. 04Altitude over a project instead of immersion in it
  5. 05The picture that prevents a woman from perfecting the wrong part
  6. 06What she must have before she can correct anything wisely
  7. 07The whole, at a glance
  8. 08Perspective made into a document
  9. 09A map of the made thing, complete enough to work from
  10. 10Sight over a matter — the beginning of oversight
surveysummaryoutlinebig picturesynopsisreviewperspectivedigestsketchwhole view
Study Overview
Architect CEO

Outline

noun · the office and the resource

The structure itself — she does not carry an outline, she has become the outline others build to.

  1. 01The frame that shows where every part belongs
  2. 02The edge that defines a shape and excludes everything else
  3. 03A plan reduced to its load-bearing lines
  4. 04The order of the work, written before the work
  5. 05What makes a thing possible to finish, because its parts are known
  6. 06The skeleton a house is hung on
  7. 07Structure given away so others can build to it
  8. 08The standard in visible form
  9. 09A woman so ordered that people take their shape from her
  10. 10The overview, now drawn as a frame
frameworkstructureplanskeletonshapecontourblueprintlayoutschemeframe
Study Outline
Sovereign CEO

Overviews

noun · the office and the resource

Plural — outlines in increase. She holds the whole of many things at once: seeing, and overseeing.

  1. 01The whole of many matters held in view at the same time
  2. 02Outlines multiplied — every house, business and family surveyed
  3. 03The capacity that makes oversight possible
  4. 04Seeing and overseeing: the difference between a worker and a governor
  5. 05Altitude become permanent
  6. 06The estate readable at a glance, room by room
  7. 07What she can be trusted with because she can see it all
  8. 08Summaries she can hand to others so they can build
  9. 09Increase measured in scope of sight
  10. 10The perfected form of the first single overview
surveyssummariesoutlinesoversightperspectivesreviewsdigestsbig picturessynthesesmany views
Study Overviews

Adventure dresses her to be profitable. Architect dresses her to be profitable and sovereign. Sovereign dresses her to prosper. Same law, better clothes.

Proprietary planner system · Patent pending